Journal: Nature Immunology

Article Title: A humanized mouse that mounts mature class-switched, hypermutated and neutralizing antibody responses

doi: 10.1038/s41590-024-01880-3

Figure Lengend Snippet: a , Left, huCD45 + PBMCs reconstitution at indicated time points in THX ( n = 11), huNBSGW ( n = 6) and huNSG ( n = 5) mice grafted with cord blood huCD34 + cells. Engraftment levels depicted as percentage of total (human plus mouse) CD45 + PBMCs. Arrow denotes the beginning of E2 treatment in huNBSGW mice that would later become THX mice (dark navy line starting at 18 weeks of age) and continuing thereafter. Right, Human and mouse CD45 + PBMCs (% total PBMCs), as identified by flow cytometry. Fluorescence-activated cell sorting (FACS) plots are from one THX, one huNBSGW and one huNSG mouse, each representative of five mice. b , huCD45 + mononuclear cell counts in THX, huNBSGW and huNSG mice. c , Total serum huIgM, huIgD, huIgG, huIgA and huIgE (expressed as µg equivalents per ml, µg eq ml −1 ) in THX ( n = 6), huNBSGW ( n = 5) and huNSG ( n = 7) mice—huIgD and huIgE were undetectable in huNBSGW and huNSG mice. d , Survival of THX ( n = 48), huNBSGW ( n = 23) and huNSG ( n = 18) mice through 55 weeks after huCD34 + cell engraftment (Kaplan–Meier curves, THX versus huNSG mice, P = 0.0323; THX versus huNBSGW mice, P = 0.1809, log-rank Mantel–Cox test). e , Number of huB cells (huCD45 + CD19 + ), huT cells (huCD45 + CD3 + ), huDCs (huCD45 + CD3 − CD14 − CD11c + ), huNK cells (huCD45 + CD3 − CD56 + ) and human monocytes (huCD45 + CD3 − CD14 + ) per ml of peripheral blood in THX, huNBSGW and huNSG mice (same mice as in b ). f , Human immune cell profiling of THX mouse ( n = 5) spleen huCD45 + cells analyzed by high-parameter cytometry with time-of-flight (CyTOF) analysis of 30 human markers. THX mouse spleen huCD45 + lymphoid and myeloid cell proportions were similar to those in spleens of humans ( n = 6) who died from accidental death (Supplementary Table ). g , BM huCD34 + cells in THX ( n = 3), huNBSGW ( n = 3) and huNSG mice ( n = 3). In the histograms ( b , c and g ), each dot represents an individual mouse, and the bar depicts the mean with s.e.m. Statistical significance ( c and g ) was assessed using two-sided Student’s unpaired t -test (NS, not significant; * P < 0.05, ** P < 0.01, *** P < 0.001).

Article Snippet: Serially diluted samples were incubated at room temperature in 96-well plates pre-coated with goat anti-huIgM antibody (2020-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgD antibody (2030-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgG antibody (huIgG1, huIgG2, huIgG3 and huIgG4, 2015-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgA antibody (2050-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgE antibody (GE-80A, ICL Labs, 1.0 μg ml −1 ), NP 4 -BSA (four NP molecules per one BSA molecule, Biosearch Technologies, 1.0 μg ml −1 ), DNP 5.6 -BSA (average of 5.6 DNP molecules per one BSA molecule, Cosmo Bio USA, 1.0 μg ml −1 , referred to as DNP 5 in the and figure legends), BSA (Biosearch Technologies, 1.0 μg ml −1 ), S . Typhimurium flagellin (2.0 μg ml − 1 ) or SARS-CoV-2 Spike S1 RBD peptide (37 amino acid core peptide, FRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPL, ABI Scientific, 2.0 μg ml −1 ) in 0.1 M sodium carbonate/bicarbonate buffer at pH 9.6.

Techniques: Flow Cytometry, Fluorescence, FACS, Cytometry

Journal: Nature Immunology

Article Title: A humanized mouse that mounts mature class-switched, hypermutated and neutralizing antibody responses

doi: 10.1038/s41590-024-01880-3

Figure Lengend Snippet: a , Identification of circulating huCD45 + PBMCs in non-intentionally immunized THX mice ( n = 7) by flow cytometry. huCD45 + cells account for 92−96% of total (human plus mouse) CD45 + cells in blood of THX mice. b , THX ( n = 6 of the 7 as in Fig. ) and huNBSGW ( n = 6 of the 7 as in Fig. ) mice were injected i.p. with DNP-CpG (50 μg in 100 µl PBS) at day 0, boosted on day 14 and euthanized on day 28. (Top left row) Peyer’s patches in THX mice and lack thereof in huNBSGW mice. (Top right row) huCD3 + CD4 — CD8 — , huCD3 + CD4 + , huCD3 + CD8 + , huCD3 + CD4 + CD8 + T cells and huCD3 + CD4 + CXCR5 + PD-1 + T FH cells. (Middle row) MZ huCD19 + IgM + IgD + CD27 + B cells (20.4% ± 0.7% huB cells), huIgM + and huIgG + B cells, GC huCD19 + CD38 + CD27 — IgG + and GC huCD19 + CD38 + CD27 — IgA + B cells, class-switched memory huCD27 + huIgD — B cells, huCD19 + CD27 + CD38 + CD138 + PBs and huCD19 — CD27 + CD38 + CD138 + PCs in Peyer’s patches of DNP-CpG-immunized THX and huNBSGW mice. Due to the extreme paucity of cells in barely detectable Peyer’s patches of huNBSGW mice, not enough events could be collected for a meaningful analysis. Flow cytometry plots are from one THX and one huNBSGW mouse, each representative of 6 mice. huCD45 + cells were pre-gated in all FACS analyses. Captions on top of FACS plots indicate pre-gating markers. (Bottom row) Quantification of huMZ B cells, class-switched huB cells, huGC B cells, huMBCs and huPBs/PCs in Peyer’s patches of THX and huNBSGW mice. Each dot represents an individual mouse, the bar depicts the mean with s.e.m. Statistical significance was assessed by two-sided Student’s unpaired t -test (NS, not significant; *** P < 0.001).

Article Snippet: Serially diluted samples were incubated at room temperature in 96-well plates pre-coated with goat anti-huIgM antibody (2020-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgD antibody (2030-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgG antibody (huIgG1, huIgG2, huIgG3 and huIgG4, 2015-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgA antibody (2050-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgE antibody (GE-80A, ICL Labs, 1.0 μg ml −1 ), NP 4 -BSA (four NP molecules per one BSA molecule, Biosearch Technologies, 1.0 μg ml −1 ), DNP 5.6 -BSA (average of 5.6 DNP molecules per one BSA molecule, Cosmo Bio USA, 1.0 μg ml −1 , referred to as DNP 5 in the and figure legends), BSA (Biosearch Technologies, 1.0 μg ml −1 ), S . Typhimurium flagellin (2.0 μg ml − 1 ) or SARS-CoV-2 Spike S1 RBD peptide (37 amino acid core peptide, FRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPL, ABI Scientific, 2.0 μg ml −1 ) in 0.1 M sodium carbonate/bicarbonate buffer at pH 9.6.

Techniques: Flow Cytometry, Injection

Journal: Nature Immunology

Article Title: A humanized mouse that mounts mature class-switched, hypermutated and neutralizing antibody responses

doi: 10.1038/s41590-024-01880-3

Figure Lengend Snippet: a – f , THX ( n = 7), huNBSGW ( n = 7) and JAX NSG huCD34 ( n = 4) mice were injected i.p. with NP 16 -CGG (100 μg in 100 μl alum) on day 0, boosted (100 μg in 100 μl PBS) on day 14 and euthanized on day 28. a , Total serum human immunoglobulin and NP 4 -specific human antibodies measured by ELISAs. Total human immunoglobulin concentrations expressed as μg eq ml −1 and NP 4 -specific human antibodies expressed as relative units (RUs). Fewer than seven data points were derived for human immunoglobulins other than NP 4 -specific huIgM, huIgG and huIgG1. b , Left, spleen huIgM + , huIgG + and huIgA + B cells, class-switched memory huCD27 + IgD − B cells and huCD27 + CD38 + PBs/PCs. Right, NP-specific huCD19 + B cells and memory huCD19 + CD27 + IgG + B cells (identified by binding of PE-labeled NP 16 ), and MZ huCD19 + IgM + IgD + CD27 + B cells in THX mouse spleen. c , Spleen huB cell intracellular AID and BLIMP-1 expression in THX and huNBSGW mice. d , Left, point mutation frequencies (change/base) in spleen huB cell huV H DJ H -C H transcripts of THX 406, 407, 408 and 409 mice depicted as scatterplots. Each dot represents a single sequence and the bar depicts the mean with s.e.m. Right, means of total, S and R huV3 mutation frequencies in FR1, CDR1, FR2, CDR2 and FR3 of huV H DJ H -C H transcripts depicted as histograms. e , In the SHM pie charts, slices depict proportions of huV H DJ H -C H transcripts carrying given numbers of point mutations; slice gray gradients depict increasing numbers of point mutations; the overall mutation frequency is listed below each pie chart. Spectrum of point mutations depicted as donut charts (same mice as in d ). f , huV1DJ H -Cγ1 B cell clones and intraclonal diversification in THX mice (same mice as in d ) depicted by TreeMaps and phylogenetic trees. Individual rectangle or square (unique color) area reflects huB cell clone size. In THX 406, 407, 408 and 409 mice, the three largest huV1DJ H -Cγ1 clones accounted for 42.9%, 26.6%, 32.0% and 23.4% of huV1DJ H -Cγ1 B cells. g – p , THX ( n = 7), huNBSGW ( n = 7) and JAX NSG huCD34 ( n = 4) mice were injected i.p. with DNP-CpG (50 μg in 100 μl PBS) on day 0, boosted (50 μg in 100 μl PBS) on day 14 and euthanized on day 28. g , Total serum immunoglobulin concentration (μg eq ml −1 ) and DNP 5 -specific human antibodies (RUs) measured by specific ELISAs. Fewer than seven data points were derived for DNP-specific huIgE. h , Spleen huB cells, huMBCs and huPBs/PCs as in b . i , huCD45 + huCD19 + B cells, huCD3 + T cells, huCD11c + DCs, huCD14 + monocytes, memory huCD19 + CD27 + B cells, huCD27 + CD38 + PBs/PCs as well as huIgM + , huIgD + , huIgG + and huIgA + B cells in THX mouse mesenteric LNs and spleen. j , Blood and spleen MZ huCD19 + IgM + IgD + CD27 + B cells (8.1% ± 0.3% and 12.9% ± 0.2% huB cells, respectively) in THX ( n = 6) and huNBSGW ( n = 6) mice. FACS plots are from one THX and one huNBSGW mouse, each representative of six mice. k , Total and DNP 5 -specific huIgM, huIgG and huIgA ASCs in THX mouse spleen and BM, as analyzed by specific ELISPOTs. l , Spleen huB cell intracellular AID and BLIMP-1 expression in THX and huNBSGW mice. m , Total human immunoglobulin (μg eq ml −1 ) in the BALF of THX ( n = 5) and huNBSGW ( n = 5) mice. n , huCD45 + cells, huCD19 + B cells, huCD3 + T cells, and huIgM-, huIgD- and huIgA-producing cells in THX mouse lamina propria (immunofluorescence; scale bar, 100 μm). Different pseudocolors denote different cells. o , p , Free and bacteria-bound huIgD and huIgA in feces of THX ( n = 5) and huNBSGW ( n = 5) mice measured by specific ELISA (μg eq/g, THX versus huNBSGW mice: huIgD, P < 0.0001; huIgA, P = 0.007, two-sided Student’s unpaired t -test) and identified by flow cytometry (% total bacterial cells). Flow cytometry plots ( b , c , h , i and l ) are from one THX, one huNBSGW or one JAX NSG huCD34 mouse, each representative of three mice. huCD45 + cells were pre-gated in all FACS analyses. ELISPOT images ( k ) and micrographs ( n ) are from one THX mouse representative of five mice. In the histograms ( a , g , j , m and o ), each dot represents an individual mouse and the bar depicts the mean with s.e.m. Statistical significance ( a , g , j and m ) was assessed by two-sided Student’s unpaired t -test (NS, not significant; * P < 0.05, ** P < 0.01, *** P < 0.001).

Article Snippet: Serially diluted samples were incubated at room temperature in 96-well plates pre-coated with goat anti-huIgM antibody (2020-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgD antibody (2030-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgG antibody (huIgG1, huIgG2, huIgG3 and huIgG4, 2015-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgA antibody (2050-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgE antibody (GE-80A, ICL Labs, 1.0 μg ml −1 ), NP 4 -BSA (four NP molecules per one BSA molecule, Biosearch Technologies, 1.0 μg ml −1 ), DNP 5.6 -BSA (average of 5.6 DNP molecules per one BSA molecule, Cosmo Bio USA, 1.0 μg ml −1 , referred to as DNP 5 in the and figure legends), BSA (Biosearch Technologies, 1.0 μg ml −1 ), S . Typhimurium flagellin (2.0 μg ml − 1 ) or SARS-CoV-2 Spike S1 RBD peptide (37 amino acid core peptide, FRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPL, ABI Scientific, 2.0 μg ml −1 ) in 0.1 M sodium carbonate/bicarbonate buffer at pH 9.6.

Techniques: Injection, Derivative Assay, Binding Assay, Labeling, Expressing, Mutagenesis, Sequencing, Clone Assay, Concentration Assay, Immunofluorescence, Bacteria, Enzyme-linked Immunosorbent Assay, Flow Cytometry, Enzyme-linked Immunospot

Journal: Nature Immunology

Article Title: A humanized mouse that mounts mature class-switched, hypermutated and neutralizing antibody responses

doi: 10.1038/s41590-024-01880-3

Figure Lengend Snippet: a – c , Naïve huIgM + IgD + B cells isolated from blood of healthy humans ( n = 3, HS 14, 15, 16) and spleens of non-intentionally immunized THX mice ( n = 3, THX 442, 443, 444) were cultured for 120 h upon stimulation with: ( a ) CD154 (3 U/ml), huIL-2 (100 ng/ml), huIL-4 (20 ng/ml) and huIL-21 (50 ng/ml), ( b ) CpG ODN2395 (2.5 mg/ml), huIL-2, huIL-21, TGF-β (4 ng/ml) and retinoic acid (4 ng/ml), or ( c ) CpG ODN2395, huIL-2, huIL-4 and huIL-21. Identification of huIgM + , huIgD + , huIgG + , huIgA + or huIgE + B cells, huCD27 + IgD – class-switched memory-like B cells (huMB) and huCD27 + CD38 + PBs by flow cytometry. huCD45 + CD19 + cells were pre-gated in all FACS analyses. d , AICDA , PRDM1 , V H DJ H -Cμ, V H DJ H -Cγ1, V H DJ H -Cα1 and V H DJ H -Cε transcript expression in HS and THX mice huB cell microcultures ( n = 3 biological replicates for each different microculture), as measured by qPCR and normalized to HPRT1 expression (2 −ΔCt method). In histograms, each dot represents transcript expression from one human or one THX mouse huB cell microculture and the bar depicts the mean with s.e.m. Statistical significance ( d ) was assessed by two-sided Student’s unpaired t- test (NS, not significant).

Article Snippet: Serially diluted samples were incubated at room temperature in 96-well plates pre-coated with goat anti-huIgM antibody (2020-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgD antibody (2030-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgG antibody (huIgG1, huIgG2, huIgG3 and huIgG4, 2015-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgA antibody (2050-01, SouthernBiotech, 1.0 μg ml −1 ), goat anti-huIgE antibody (GE-80A, ICL Labs, 1.0 μg ml −1 ), NP 4 -BSA (four NP molecules per one BSA molecule, Biosearch Technologies, 1.0 μg ml −1 ), DNP 5.6 -BSA (average of 5.6 DNP molecules per one BSA molecule, Cosmo Bio USA, 1.0 μg ml −1 , referred to as DNP 5 in the and figure legends), BSA (Biosearch Technologies, 1.0 μg ml −1 ), S . Typhimurium flagellin (2.0 μg ml − 1 ) or SARS-CoV-2 Spike S1 RBD peptide (37 amino acid core peptide, FRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPL, ABI Scientific, 2.0 μg ml −1 ) in 0.1 M sodium carbonate/bicarbonate buffer at pH 9.6.

Techniques: Isolation, Cell Culture, Flow Cytometry, Expressing

Journal: Immunity

Article Title: Profiling B cell immunodominance after SARS-CoV-2 infection reveals antibody evolution to non-neutralizing viral targets

doi: 10.1016/j.immuni.2021.05.001

Figure Lengend Snippet:

Article Snippet: Goat anti-human IgD-HRP , Southern Biotech , Cat# 2030-05; RRID: AB_2795627.

Techniques: Virus, Clinical Proteomics, Infection, Recombinant, RNA Binding Assay, Transfection, Enzyme-linked Immunosorbent Assay, Bioprocessing, Multiplex Assay, Isolation, Gene Expression, Plasmid Preparation, Software